PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do024632.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB
Protein Properties Length: 536aa    MW: 57480.6 Da    PI: 9.182
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do024632.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.2e-152670348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT++ de l+ +v+ +G + W+ I ++++ gR +kqc++rw +yl
       Do024632.1 26 PWTEDKDEALKTLVTIHGEKKWSVIQHHLP-GRIGKQCRERWTNYL 70
                     8*****************************.*************97 PP

2Myb_DNA-binding55.41.4e-17192238148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT++Ede l+ +v+ +G++ W++Ia+ ++ gR +kqc++rw ++l
       Do024632.1 192 KGPWTEQEDEALKALVAYHGMKKWAAIAKSIP-GRIGKQCRERWTNHL 238
                      79******************************.************996 PP

3Myb_DNA-binding491.4e-15248288345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+++de+l+ a+k +G++ W+ Iar +  gR+++++k++w+
       Do024632.1 248 IWTEQDDEQLIMAHKIHGNR-WSMIARDLY-GRSENSVKNHWN 288
                      6*******************.********9.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.0431974IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-202376IPR009057Homeodomain-like
SMARTSM007171.3E-132372IPR001005SANT/Myb domain
PfamPF002496.8E-132670IPR001005SANT/Myb domain
SuperFamilySSF466892.58E-162675IPR009057Homeodomain-like
CDDcd001676.67E-142670No hitNo description
Gene3DG3DSA:1.10.10.602.1E-22187240IPR009057Homeodomain-like
PROSITE profilePS5129427.186187242IPR017930Myb domain
SMARTSM007177.2E-17191240IPR001005SANT/Myb domain
SuperFamilySSF466896.36E-29191287IPR009057Homeodomain-like
PfamPF002492.7E-16192238IPR001005SANT/Myb domain
CDDcd001673.48E-15194238No hitNo description
Gene3DG3DSA:1.10.10.601.3E-15241292IPR009057Homeodomain-like
PROSITE profilePS5129416.19243295IPR017930Myb domain
SMARTSM007171.7E-13245293IPR001005SANT/Myb domain
CDDcd001671.72E-11249291No hitNo description
PfamPF002491.9E-12249288IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MPNAVLRAAG WRVAVAGVQR QPRASPWTED KDEALKTLVT IHGEKKWSVI QHHLPGRIGK  60
QCRERWTNYL RPNIDKPRAR GADMEGGSSV GFGHGVAAGP VHPRYSGGGT GAQAVMPGAG  120
IIPAGMSTLL FGVGMPAPGG NMVQPGPGGY LAAAGNGAMP LCAGWNRVAG AGAQQQPGRA  180
GGGVINKPPP QKGPWTEQED EALKALVAYH GMKKWAAIAK SIPGRIGKQC RERWTNHLRP  240
NIEKRKDIWT EQDDEQLIMA HKIHGNRWSM IARDLYGRSE NSVKNHWNAT KRSLNSKRRI  300
KKKKNPEARP GQQWSVLEMY IRSQLPDADA KPEAAAPDSP PSSESDDIGY GEVVAPLPQP  360
GFNPAVMGLY LNSAGSSSSA MGLYLNSAGS SSSAMGAAVM NPNVDLGLGL DAYYGAPQQQ  420
PLQAAMNQQQ LMMMGHDQQK AAATSYYANL QMSYHQFVDN LAWHSSVHAE NANAAAHHQP  480
YYYYYYGDAG AGPSGTAGSS GGGSGDDDID VVQMASREFQ LNPTEEEVTL NLAGFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-331882963110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK4ALU71e-91K4ALU7_SETIT; Uncharacterized protein
STRINGSi039882m4e-91(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.14e-38myb domain protein 118